DPCstruct | MC25176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 267 |
|---|---|
| Mean domain length (aa) | 141 ± 26 aa |
| Standard deviation of domain lengths | 25.68 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.30 |
| Pfam Score | 73.59 |
| Assigned Pfam label(s) | PF00200- CL0750- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EKQ5 | 7-102 | CCDKNTCKFTRNAKCASGLCCNLNTCQLKKNSLCREAAGECDVEEVCDGASNHCPVDRHVNNTTPCQVGGGGFCFDGECNSHDKACQ… |
| A0A2I2YYD5 | 336-482 | EDFAHFISKQKSQCLHNQPRLDPFFKQQAVCGNAKLEAGEECDCGTEQDCVLIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKER… |
| A0A1B0AIJ0 | 67-238 | None |
| A0A2I3M3V3 | 371-518 | None |
| T1F641 | 234-411 | None |
| T1ENU0 | 102-273 | None |
| A0A6J3EK86 | 629-779 | None |
| I8U2E9 | 675-831 | None |
| A0A811LGU7 | 299-441 | None |
| A0A498LQC5 | 385-531 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.