DPCstruct | MC25175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 312 ± 32 aa |
| Standard deviation of domain lengths | 31.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.45 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0123- PF00140- PF03979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0WWH4 | 2-255 | YLMQMGEIPMLDRKSEVTAAKRIERTRLSFRRTMLCNDFMLHAAIDLLQKVADGNLRLDRTIEISVTNTAEKKRVLKRIGPNVATAR… |
| A0A6B0WF43 | 14-317 | EIQQLIIVGKERGYLLFDEINELLPAGMSSSEELDELFSSLGNAGIEVVESEDKYKEKKRLERAAEGSDEPEFDLTPSPIDKTSDPV… |
| A0A0F3MJ57 | 18-340 | None |
| A0A349D122 | 187-467 | None |
| A0A525PKE6 | 2-309 | None |
| A0A661NR00 | 398-663 | None |
| A0A1V4QFU4 | 2-326 | None |
| Q4ECZ1 | 12-350 | None |
| A0A6P5UL51 | 17-393 | None |
| A0A377AD27 | 1-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.