DPCstruct | MC25173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 411 ± 110 aa |
| Standard deviation of domain lengths | 109.84 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A069CWK8 | 142-522 | IEVKVPLLTIKNNQFSSEITVREENQYQRWTTRGELNRSSHTIKAELYSQKKQKVYLPYLKKHFEAEVMFDSLSYSLTKTNIGSGQI… |
| A0A4V2VU36 | 3-472 | QRITVPQAVMNSGKFSSSVFLNDEEAEWLLEGKVQAEDQRMRVEVSSKEPDVELPFLYGKYGLAVSFDKLIFDLKDVKKINKKLLEI… |
| R5UKE2 | 3-424 | None |
| A0A3D4W997 | 37-553 | None |
| A0A832PVU1 | 325-831 | None |
| A0A7C4E6J3 | 304-639 | None |
| T2JY31 | 29-324 | None |
| A0A5C6U6C9 | 74-313 | None |
| A0A7K1UD94 | 79-537 | None |
| A0A3C1KWU0 | 495-889 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.