DPCstruct | MC2517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 397 ± 65 aa |
| Standard deviation of domain lengths | 65.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4RJL0 | 2-330 | INEEENSEGSMYTVDRKTVQRLIEKLELDGHIRTIKVTLKGHGREKHMTFICHPSVDQDHSEIQSAIEQAKMKLPIITKDLMKNKND… |
| A0A0D3F499 | 2-390 | KLVLEFLNQLNKKHSFVLMVELHKWLERVEKENWKIFDRKTLIRTLDKLQQEGSCKCMKVNVPVVTNYAGSRSIDVILNSSVKVMSP… |
| A0A287UBI2 | 514-914 | None |
| A0A446JEA2 | 33-413 | None |
| A0A1U8PLQ5 | 153-558 | None |
| A0A836IUN1 | 739-1108 | None |
| A0A821IME6 | 281-717 | None |
| A0A804PKM5 | 1-331 | None |
| A0A0D0UKN4 | 1-406 | None |
| A0A1E1WKX5 | 63-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.