DPCstruct | MC25168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 137 ± 19 aa |
| Standard deviation of domain lengths | 19.36 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534P4E4 | 73-249 | FELVDLRLRNWWYVGVSPDPWAGVTFGLVSFATVLPAARLGLAHVADAHPAPLRHGRLRRAFAGLAMLVLALVFPRYAFPLAWIFLW… |
| A0A6A0HG71 | 8-146 | KKPLAFPPWLLNTFVAFGFLCCTLPFLVPQAIAQYLFVFVWVGFIFLLDPMNYRAGLPSLLGELERGSVRTMLTLFVAGIICGFLWE… |
| A0A2V8A5W1 | 3-117 | None |
| A0A0S8B7G0 | 92-239 | None |
| A0A7C6B868 | 39-160 | None |
| A0A7V3RWM1 | 2-99 | None |
| A0A1F9N0B2 | 16-157 | None |
| A0A7C5VIY3 | 43-154 | None |
| A0A1J5DAJ3 | 141-275 | None |
| A0A831QJ34 | 197-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.