DPCstruct | MC25167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 353 |
|---|---|
| Mean domain length (aa) | 218 ± 55 aa |
| Standard deviation of domain lengths | 54.91 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.41 |
| Pfam Score | 82.40 |
| Assigned Pfam label(s) | PF04233- CL0363- PF06074- PF06152 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9JYZ4 | 7-120 | KLEIIAKAALKAAQKTQKLREVTKTLRTQFPELTAAEAKDGAVTAIAWVAGRASWISYMQRGRVRKTIVLCPGACEICRGNKEQGPI… |
| A0A521IRD3 | 70-252 | LKAWFDGIIDPLAEQQDFMENILPELEATFAVFAERVAESLDATYDPMNDSARVWIQEHAAELAKGVTDTTREALRETLEDGWAKGE… |
| A0A842RR77 | 155-355 | None |
| A0A1Q5SN78 | 19-168 | None |
| A0A7T5FQM7 | 5-232 | None |
| A0A838ED32 | 231-459 | None |
| A0A6L9FDB6 | 67-279 | None |
| A0A348HEC4 | 166-343 | None |
| A0A154QH82 | 164-408 | None |
| A0A3M0PU72 | 28-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.