DPCstruct | MC25161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 290 |
|---|---|
| Mean domain length (aa) | 236 ± 66 aa |
| Standard deviation of domain lengths | 66.30 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 14.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0HB43 | 121-425 | SATALYLSSSQVLMSRVATAYFEVLRANQTLKYTQSEKNTLYQTLQQQQQEYRVGLIAITGVYNAQSQYDSIVALEIANRNTLSDRL… |
| A0A2V8FQ14 | 115-332 | LARVNLNVLLNRPPDAPIGPLTGAGEAILNATLQDLQRSAVEQQPELRMAQIQVEQAEAQLAVTKSDYKPDFSVTGGYLLMPNQTDA… |
| A0A538QE89 | 87-402 | None |
| A0A1P8WEX5 | 589-904 | None |
| A0A1H0R6F2 | 325-670 | None |
| A0A0N0VKI6 | 3-147 | None |
| A0A6S5IHC2 | 17-211 | None |
| A0A534W7R4 | 423-595 | None |
| A0A1I5C8C9 | 40-460 | None |
| H8H0Q5 | 48-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.