DPCstruct | MC2516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 213 ± 38 aa |
| Standard deviation of domain lengths | 37.83 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.88 |
| Pfam Score | 97.47 |
| Assigned Pfam label(s) | CL0361- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3D3U3 | 517-706 | FRRDEFSSHFTNVHGDVHAGLNGWMEHRCPLAFYGCTFSQRRFYPTSPGAQVVHSRLLRSFGVQPHPGAQLSGDSQSDRFSELPTEI… |
| A0A183AKB4 | 9-207 | LHIITISGILFFQSCCDRLVQRSKANSHFRFHSDFLVPLNDSIELRCPLHHLGCDFIATRMLPHFSDTSTVPPPDASDGDTHLTSNV… |
| A0A4Z2CAD5 | 2-188 | None |
| A0A553RBT0 | 490-678 | None |
| A0A6P8GSX5 | 376-588 | None |
| A0A3S4QZS5 | 302-431 | None |
| A0A6J8BDI6 | 2-225 | None |
| A0A182ENT0 | 81-343 | None |
| A0A7R9NZX4 | 119-331 | None |
| A0A7R9FS63 | 213-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.