DPCstruct | MC25156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 180 ± 21 aa |
| Standard deviation of domain lengths | 20.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2THD4 | 14-178 | IMLIIELGLVIVTMSLLCCAYPERFRRTLWEIGGENGWNSNPRLRIYFYANYQQPPEIPLIWAQRLSESNLAISVLATAICSTRIIL… |
| A0A3M7HXH6 | 108-276 | RIPKAMIALLALELPLTVATLTLYGVADPNTYRTKLWQNGYDQGFNSAPNSILYDYANYRTPHVPMVWSAYLVQFNIVISVFSTFIL… |
| A0A6A6PME4 | 22-221 | None |
| A0A0U5G6X1 | 3-193 | None |
| A0A2N6NF80 | 23-197 | None |
| A0A093Y4C5 | 767-958 | None |
| X0AX60 | 32-205 | None |
| A0A1J9RA95 | 19-215 | None |
| L7J2S9 | 31-202 | None |
| A0A4S8RCE6 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.