DPCstruct | MC25153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 5.19 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850MTT9 | 1-84 | MALNIDELKERTKEYVEIEGKTKVINVVFAGRFILFDIEDVVLSVKTIEKDESEWWVVGGSTPMNLYAKSRFPSADEAFSMHLG |
| A0A2V6H5I3 | 7-83 | ELVRRAKDYVELEANTKVRDVTFAEKFRLFGREDIVLSVSTTDKEEPDWWVVGGSTPMNLYAKSHFRTADEAFSMHT |
| J6J5S0 | 1-92 | None |
| A0A7Z0TSA6 | 1-80 | None |
| A0A533BHA0 | 28-116 | None |
| A0A7W7D5K1 | 1-80 | None |
| A0A1L7CJ25 | 3-90 | None |
| A0A7Z0E1Q6 | 2-81 | None |
| A0A4R8E3Z1 | 34-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.