DPCstruct | MC25151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9N2Y9 | 2-107 | SIKAECHSDDRVREASFDAAPYFVQASAESIGALAECGWGGDYPADYVAQFMAEHNKEVRLMFKYLDLVSDKKDAPGFECHVDEADA… |
| S7I0Z2 | 9-125 | ASENQCKRRIEVQAVCYSDDQQKRVEFDAAPYFHEQLINGRLEKVIQSLIDIEFGGDYDSDNVCEFFSASQTKPLFDYLDVVNRGRP… |
| A0A5H2Z3U5 | 123-222 | None |
| A0A233HUT0 | 62-167 | None |
| A0A5E4W3M7 | 167-280 | None |
| A0A2D8QZX6 | 90-195 | None |
| A0A1H5P166 | 2-98 | None |
| A0A177JKJ7 | 2-101 | None |
| A0A7Z1UNQ9 | 78-192 | None |
| A0A3S0DF02 | 25-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.