DPCstruct | MC25150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 13.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644ZXE4 | 1-98 | MSRAPVFNCQTIENAANLALRLQEKILQKQLQKWAEETSQHLQLKELQSWQRGPLLYLRLVFNTDEAMGMNMVSVATQKIAEELEKK… |
| A0A4E9EZM3 | 4-98 | DGMTRAPVVQFANVARTLEMKDFLDSSTGFEEIKAVFDSTSSFARLQRLETDITGRLLFIRFEAKTGDAMGMNMVSKGTNAALSYLK… |
| A0A1Y2HJ60 | 582-673 | None |
| A0A1Y6CMG5 | 238-347 | None |
| A0A100I825 | 50-156 | None |
| A0A835HKD0 | 1-95 | None |
| A0A1A9VQ21 | 81-169 | None |
| A0A2U3EJP4 | 97-202 | None |
| A0A7S1KNL2 | 156-256 | None |
| A0A3E0NW26 | 281-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.