DPCstruct | MC2515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 259 ± 40 aa |
| Standard deviation of domain lengths | 39.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4U5Y4 | 3-190 | DDALLEFGSIGEYAALRYHTQRLSESIPEELMETIMTMMLSENPYHHMFGYRIIQNITDRHYNRLEFENPRGVNYNIRVAKYSARDR… |
| A0A183AJH0 | 44-305 | TMVDGRSQTSSEERQFQEAIINTIAEFAKNLPDTQKIEILKFILNFEPMAKYHPENGIRPRPLIMVLLQTMLTVATQYRTVAISNAL… |
| A0A815F5G1 | 148-379 | None |
| T1FS07 | 336-583 | None |
| A0A6H5HX92 | 219-533 | None |
| B4NSB5 | 33-268 | None |
| A0A2B4S862 | 314-595 | None |
| A0A183N7I2 | 16-206 | None |
| A0A815MSE3 | 2-243 | None |
| A0A0B7N2Z6 | 145-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.