DPCstruct | MC25149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 107 ± 26 aa |
| Standard deviation of domain lengths | 25.54 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.13 |
| Pfam Score | 98.57 |
| Assigned Pfam label(s) | CL0080- PF07544 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9USG3 | 30-140 | LNVDNKNWQSIVCRRCDSLILFEDKVNLLEGGYKAKLPIMTPGAKNTTDTEDISWWWHSNDDFDFDTIGYAMPMVDGKKILVCGDCE… |
| A0A4E9ERG6 | 8-97 | LSPNVASFVDAKPFSLPFCRQAKNSTSINAEVINSWWQVERMFDFENIGFTHARDGVKYLICANCEDGPVGYLCPVTKAHFVAVCRV… |
| E1C3Q7 | 25-144 | None |
| A0A091DQK8 | 46-103 | None |
| A0A7S0DAA9 | 56-188 | None |
| A0A7S0IWL8 | 107-231 | None |
| A0A2T7NJ64 | 18-129 | None |
| A0A507E3E6 | 29-150 | None |
| A0A183TQD7 | 15-83 | None |
| L8H520 | 5-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.