DPCstruct | MC25148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 146 ± 32 aa |
| Standard deviation of domain lengths | 32.45 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.65 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF07842- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1P6BGG2 | 2-137 | WYNEWKSRFPVEISSLIIVQEQLKRALIAMKQAQQGVQVTKEIHPPLPPPEPVPGIYNSAPPRIQPPPPHLSFKDLVELRAREAGVL… |
| A0A6M2CUW4 | 2-79 | QTIRTSTTPANAQMTFKELIEQRAQEKNLLFVPMAHRFQEGKQVYRLGHVMLYLDRNVIFVFNGKTWVPTSLQSLLDM |
| A0A146IN68 | 89-267 | None |
| A0A6S7HG24 | 270-418 | None |
| A0A815GFJ3 | 299-441 | None |
| A0A7S0LXS6 | 174-360 | None |
| A0A0C9UA76 | 31-205 | None |
| A0A0N5CPL3 | 26-183 | None |
| A0A816CAH4 | 11-139 | None |
| A0A1R3ID73 | 57-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.