DPCstruct | MC25144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 6.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7J284 | 31-101 | GVKMGVDMVFASFIRDAAGVKEIRQVLGEEGKNIKIISKIENHQGCKNIDSIIDESDGIMIARGDLGIEIP |
| A0A7V3WH08 | 52-114 | VAISFVRNAEDVIKVKDFIRKRKRDIPVIAKIEKPEAIKNIKDIISVSDGIMIARGDLGVEMP |
| A0A453F5V7 | 116-178 | None |
| A0A5P1ERD1 | 192-270 | None |
| A0A287L8J8 | 68-130 | None |
| A0A1A9YR78 | 346-423 | None |
| A0A356N885 | 83-144 | None |
| A0A5J6T0Z9 | 334-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.