DPCstruct | MC25142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 138 ± 21 aa |
| Standard deviation of domain lengths | 21.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17846 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094DW65 | 71-188 | LPPEVAARNTMGNDVLLVSEAHQSLYDDIATHFYSKKQGSPQYQLNPRISDGLAGKVEKNDVYLPHGSLTYPLDGDSMPSLDEDRSI… |
| A0A1I9G8D1 | 1-130 | MEDKLDAFEKERNSRGPDRLFVGPSHPFYNFAETLYENSRKDSTDLAIDTSLTFGMAGTVGVDAKAVMKGQNYKSPLSVDEFTDIAK… |
| A0A6P3Z399 | 408-539 | None |
| A0A397U4B0 | 12-201 | None |
| A0A3P7LFF9 | 275-442 | None |
| A0A2N0QY12 | 31-175 | None |
| A0A7R9A3U4 | 659-786 | None |
| A0A7S4UYI4 | 1-175 | None |
| A0A811QR24 | 32-155 | None |
| A0A6V7PXW2 | 259-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.