DPCstruct | MC25140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 531 ± 41 aa |
| Standard deviation of domain lengths | 41.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A371NXL4 | 1-500 | MLSGGLFNLNLDTLVSANGVIASVPNQVTETGVIHGPNAEADPDIHDNPLSLTALGAVTVTATGLTTTVSQLLGLIASAPDGTGLLN… |
| A0A1G6U3F2 | 9-530 | IAGLLSAALTVWVFAPTTTQAASVDRAEAEGRALTGDAGVVDLNSVVGLEGAYFADPTIPGSGFQPIDASVLTGLAELQAGVSAFGT… |
| A0A7Z0J3B0 | 1-490 | None |
| A0A6L9S661 | 2-498 | None |
| M1TU80 | 21-566 | None |
| A0A6B8WIF1 | 1-614 | None |
| A0A5C8IDC7 | 132-719 | None |
| A0A4R5A7U5 | 1-530 | None |
| B8HBV2 | 23-578 | None |
| A0A4Z0K7U6 | 12-594 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.