DPCstruct | MC2514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 175 ± 34 aa |
| Standard deviation of domain lengths | 33.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2HGZ0 | 9-164 | QTPREDGANILTVDALLQHLESAIRASRVHVYLYNRQWKLENLCYKSGELVTETHYMDQIIEKLHPCLIITPLDCFWEGAKLQSGMV… |
| A0A183AJ22 | 207-360 | QALLDHMEFLIKVRRLQITVGSAKWSFKDLCQRASLPFGSEVHPIQAYLDMIIPCLIITPLDCFWEGAKVLGPEEATWVPWLGERTL… |
| A0A3Q0KLW9 | 204-395 | None |
| A0A2G8L0D6 | 15-142 | None |
| A0A0N5DBL4 | 143-370 | None |
| A0A2A2KEN1 | 208-416 | None |
| J9DTY6 | 3-177 | None |
| A0A0A1XPI2 | 51-193 | None |
| A0A3P7DVS5 | 183-343 | None |
| A0A6P3DYF8 | 162-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.