DPCstruct | MC25139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 67 ± 1 aa |
| Standard deviation of domain lengths | 0.67 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 71.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A235AB28 | 1-66 | MNRSLPRLTRVRAARLFADESGAATAEYAIATMAAVAFAGLLVVIMRSDEVRGILTDLVRRALTVE |
| A0A371NU50 | 1-67 | MTENPIPDLTRGRAASLFTDESGAATAEYAITTMAAVAFAGLLVVIMRSDEVRGILTDLVRRALTVS |
| A0A6D1VI96 | 1-67 | None |
| A0A2W6VLN8 | 12-77 | None |
| A0A653UGX6 | 7-73 | None |
| A0A7K1TMU4 | 1-67 | None |
| A0A7Y9GN14 | 8-74 | None |
| A0A1M3AEQ1 | 2-67 | None |
| A0A2W1UJY9 | 1-65 | None |
| A0A5R1NQW1 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.