DPCstruct | MC25132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 167 ± 34 aa |
| Standard deviation of domain lengths | 34.44 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5SBK1 | 318-459 | GEELYAGFSVDERELIDYMQSVLTDLSLEEAPDDKTYTDAEFYALLGNLGYDNFSRIVKVHLDIFKALNRALRAISRVKEEESKKDL… |
| A0A172XCQ8 | 10-161 | NSGADIVKAEININAMLNSLLDKFGIPDDRKKIIDDMRDIVTGFSRVFSVRVYKNEDFCNLLEGLGAERLKEIIEIHINILKAQDEA… |
| W5SBJ5 | 10-220 | None |
| W5SPZ8 | 95-275 | None |
| T1ECR8 | 7-234 | None |
| W5SK75 | 21-209 | None |
| W5T2B1 | 154-312 | None |
| W5T6F6 | 1-144 | None |
| A0A2D1Z6L5 | 50-231 | None |
| W5SFX9 | 28-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.