DPCstruct | MC25131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 146 ± 17 aa |
| Standard deviation of domain lengths | 17.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 33.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09781 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834AY00 | 2-102 | LTGIPVVIGITLVNVFIGEAELAEIPEGYVPEHWEYYKHPISRWIARTFYDSPEKNYERTMAILQIEAEKADLRLKELEVRRLMRAR… |
| A0A2S2NNX8 | 4-143 | HHLMGIRETRWQWAKFKDLLHYYVLVGVIPLTLLITGVNVFIGPAKLAPIPEGYRPAHWEYYRHPITRWMARYIYPSPQQQYEKYLH… |
| E9H230 | 1-142 | None |
| A0A2G9UVJ2 | 2-138 | None |
| C1BNV9 | 1-138 | None |
| A0A5E4PN55 | 4-144 | None |
| A0A6A5DFX8 | 100-265 | None |
| A0A210Q5M4 | 43-204 | None |
| A0A6H5GSM1 | 794-954 | None |
| A0A5K3F225 | 33-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.