DPCstruct | MC2513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 159 ± 15 aa |
| Standard deviation of domain lengths | 15.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 50.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0J490 | 250-397 | AVSTSGSLNGKFFTREGFGDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLA… |
| A0A6I9PRB7 | 1-162 | ALAPGPGKGRGAKRKQQQQQDNSAAGAAKRTRSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPG… |
| A0A2I0T617 | 77-206 | None |
| A0A7R9P3H9 | 190-335 | None |
| A0A3P7NVC3 | 126-272 | None |
| A0A0M3ITS5 | 253-430 | None |
| A0A183JAL5 | 1-179 | None |
| A0A3Q3NP96 | 212-375 | None |
| A0A7J7JRX2 | 174-336 | None |
| A0A6J8CAY1 | 206-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.