DPCstruct | MC25128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 7.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.37 |
| Pfam Score | 63.10 |
| Assigned Pfam label(s) | CL0007- PF16274- PF16544 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3W9L7 | 45-119 | YIDVVINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKDYNDEIRQAQL |
| A0A3S5BJ32 | 15-83 | MPEASGPIITLQEKVFVPVKENPNYNFVGRLLGPRGLTAKQLEQDLECKIMVRGQGSMRDKRKINIRNM |
| A0A7R8WBW9 | 77-140 | None |
| A0A7J7KS95 | 66-136 | None |
| W8AXF3 | 68-145 | None |
| A0A2U1QAN1 | 1-84 | None |
| F6Z0E6 | 61-136 | None |
| A0A5J4NUF0 | 33-104 | None |
| G5B5T0 | 6-68 | None |
| A0A6J0CPA4 | 172-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.