DPCstruct | MC25127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 110 ± 10 aa |
| Standard deviation of domain lengths | 10.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12739 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183EHH5 | 3-95 | EEQIRQGFSPLLAVLTSDAVERIAAKNNLSFTDLLLPFATVNCTIKDPSGSSVTSRIFFDFRDLRRDGFLLSLTVLPSVLHEAVSSV… |
| A0A2S2NGE0 | 1-103 | MACDDDDDFVRGIFCPHVAVLCSDKAQEMCRKNNLNFSDLLNPFARLTDVNFKDTNGSTINVPNLQIKFSNINSQPLSVTKERSRLH… |
| K9GA55 | 94-212 | None |
| A0A4S4ESP5 | 1-103 | None |
| A0A816JBB2 | 1-111 | None |
| A0A0V0RLQ4 | 53-154 | None |
| A0A401PV56 | 1-124 | None |
| A0A2G8JDL5 | 1-122 | None |
| A0A1Y2AQ62 | 1-105 | None |
| A0A2G8KIB2 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.