DPCstruct | MC25126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 99 ± 5 aa |
| Standard deviation of domain lengths | 4.98 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01196 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8XXB1 | 2-108 | EMMEWWLPERDLVTKFFQVIVPRFINREAPFTSIYRLPTQRLLQSKKGMVEMWRRYDIAILEIDGNPFPPVLGDEPKISSSLLNILL… |
| A0A2S2NEQ0 | 6-103 | MEMADYWIEEKQLIHKLFKVLVPRFNDYQTSYTMLYRAPKAYPEIVYPRSVLELRGNPFPAILPQRSDQRNFIHNVLLDEAKKAYRA… |
| A0A814HXC8 | 411-513 | None |
| A0A4Y7N276 | 414-509 | None |
| A0A7R9KVZ7 | 4-100 | None |
| A0A183HL85 | 44-136 | None |
| A0A4Y2DAE4 | 82-186 | None |
| A0A4Y7M9X2 | 185-275 | None |
| A0A814E9I0 | 338-439 | None |
| A0A7R9HT58 | 46-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.