DPCstruct | MC25125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1UVK1 | 276-374 | AFQKAKKQRNGSVEPKTVNAFQRVKADEVVFTDERLKDNSYWAKNGAESGYGAKAQEILGQVRGRDFRHEKTKKKRGSYRGGQIDLQ… |
| A0A2S2NB17 | 11-104 | GNRSFDSDKKKKQQNRRSDPYRRVRDDNVSVDGRLLDNSLKAKKGQYENWGKKAALDLQYTKGKSFRHEKTKKKRGSYRGGQIDLGV… |
| A0A811JRA1 | 1155-1249 | None |
| A0A1X2ILF1 | 18-117 | None |
| W6UFL6 | 98-203 | None |
| A0A674HBV4 | 424-537 | None |
| A0A6P4ZMR0 | 646-738 | None |
| A0A7S1T5X8 | 182-287 | None |
| A0A4P1RV82 | 132-234 | None |
| A0A7R9T4I0 | 36-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.