DPCstruct | MC25123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 310 ± 53 aa |
| Standard deviation of domain lengths | 52.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.60 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0039- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2FCF6 | 226-573 | ASVMDYPHPYITLKDGVMDFSEAYDTGIGEWDKVTVAYSYTDFPEGTDETEGLNQILEKGQKNGLRYISDRDARPMGSAHILGHLWD… |
| A0A7W1PE04 | 35-321 | HAILEEGHKKDLWYLSNQDVSAHARVDQWANGTDSAAELNRMMEVRRVALSRFGEQAIKKGEPMATLEEVLVPLYLHHRYQVDSAAS… |
| A0A3D4PEA0 | 16-311 | None |
| A0A5D6XUH7 | 922-1256 | None |
| A0A812VIH5 | 694-1020 | None |
| A0A7R9SVS7 | 7-331 | None |
| A0A1Q9E9H6 | 22-267 | None |
| A0A2V8ZPC8 | 6-231 | None |
| W4PDI5 | 1-308 | None |
| A0A3B0R6I8 | 2-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.