DPCstruct | MC25121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 215 ± 33 aa |
| Standard deviation of domain lengths | 32.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06666 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D3K9C4 | 25-225 | EARLNLWFDHVKCQRRLGMVNLAIRQVAGRIISQDTPLDRNLLLHAPIGSQQEQLNNEVINSSLAINSNTLLLAPLRQYNPDKYEHN… |
| A0A0J1LME3 | 27-279 | LTTVMNRLYKEASSIKQSRTILADVLLRQGNEHANKKAVNYACAKSRRLIAISELNAWSPTMNVGNNLPLAGTTKSSPPAGMPYLTI… |
| A0A2Z5A8K0 | 44-185 | None |
| A0A2N2AMU6 | 219-467 | None |
| A0A059E0L3 | 9-242 | None |
| A0A4Q3Y4L6 | 267-532 | None |
| A0A847BKK7 | 1-212 | None |
| A0A4Q3Y0W1 | 129-356 | None |
| A0A1I9Z4A2 | 2-228 | None |
| A0A179BND8 | 148-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.