DPCstruct | MC25120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 26.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A250ETU6 | 6-96 | LDLILRKEVEKIFGKSVKDKRDSELLSDRISEEIREQISSQTIRRFWKLIQNGSNISPQTKDIFCRYIGFNDFKAFAENVQNNRVNT… |
| A0A0Q5U1F9 | 28-103 | EKIAQLKVLVAQKSGLDYIKPEDCKGLSEQIFIKTNNYLSEKTLKMFFVENRKEATPFILNCLAQFAGFGDWNQYL |
| R7P731 | 15-112 | None |
| I2GRD7 | 7-96 | None |
| A0A3B9GS34 | 1-94 | None |
| A0A5B3GU81 | 1-118 | None |
| A0A2X2RP08 | 12-110 | None |
| A0A1Q3UJ39 | 7-100 | None |
| A0A414F998 | 3-82 | None |
| A0A0C1G7R9 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.