DPCstruct | MC25118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834EKX9 | 98-210 | NLSLRNEIAKETLPDLVSIIPDTVPTTDVLIETTASACYTLNNIIQTNYQNARDLLNTGGLHKIMAISADDSYGSNKASKAASVLLY… |
| A0A6A4RU80 | 24-141 | LRNLSRHANDKGNMASKVVNNLVPKLPADAHQKEPSSDVVVNICGILNNLVTGSTLAAKEIAFFDGLTKLVAIKNGGGSSAGKMKAA… |
| A0A3Q4B448 | 119-226 | None |
| A0A671LQM8 | 516-652 | None |
| A0A4Z2J362 | 1-109 | None |
| A0A485NQW4 | 81-222 | None |
| A0A834AN65 | 727-864 | None |
| A0A6I9PXD6 | 33-140 | None |
| A0A0S7JHK5 | 252-375 | None |
| A0A1S3QUV5 | 77-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.