DPCstruct | MC25117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 2.95 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 62.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15320 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4TJF0 | 65-113 | TETLQKYEELFAHRFSSEDQEYQQYLNRPADPPPIVEDWRGNQRGRDNR |
| H2LE75 | 1-55 | MSEATETLKGYEELFVNRFTSEDQEYQEYLNRPADPPPIVEDWRGRAGGNQRELG |
| A0A6A5FBK9 | 25-76 | None |
| H9GKA3 | 39-94 | None |
| A0A7J7FGZ8 | 296-350 | None |
| A0A091VH07 | 1-57 | None |
| A0A4Z2G8N8 | 1-51 | None |
| A0A7J5X776 | 40-89 | None |
| A0A672G668 | 1-59 | None |
| G5C9I7 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.