DPCstruct | MC25116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 30.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5FTD5 | 112-177 | GRALGETQKKALAAFRKGLAEGSINLFTGPLNFQDGSLFLKIGTTATDEQIWYLPQLLAGMEGASK |
| A0A1V5K669 | 14-76 | MVPEEVKELVEAEKQKIISGEKDVFTGPIKDQNGAVRVPEGTAMTDAEMLDFDWFVEGVEGTI |
| A0A0F9EPB7 | 70-143 | None |
| A0A1V2LZS4 | 56-118 | None |
| A0A838RF79 | 156-226 | None |
| A0A645J7C0 | 1-67 | None |
| A0A7W5Q5P0 | 2-55 | None |
| A0A4Q3PDY6 | 34-95 | None |
| A0A0H3ASR0 | 325-399 | None |
| R6HAE6 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.