DPCstruct | MC2511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 155 ± 28 aa |
| Standard deviation of domain lengths | 27.52 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7DPX9 | 82-201 | DEVLVTATRAIFVEENEYRMAPAAVVGVTIKHRKFVDFFKNETYKCPSYPSRDSSCKKAKTCESTSLNCYLLDDNGFIIASENEDDT… |
| A0A183AAK7 | 13-137 | VVMAVVGLQLTHSQLKAIFDRVTNSCVAGHCQPCGSPNVHCYVINQAALVLVSSKGEKEVGQSLKEINCALVEAMVNQSALTQYYLY… |
| A0A6S7GCG1 | 510-622 | None |
| A0A3L8SGU0 | 1-118 | None |
| T1KVS2 | 34-159 | None |
| A0A498P0J3 | 11-172 | None |
| A0A4W5NZH4 | 146-300 | None |
| A0A2J7PJ39 | 476-640 | None |
| A0A4Z2J1Z4 | 155-353 | None |
| A0A0K2VK47 | 3-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.