DPCstruct | MC25108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397EID1 | 1-74 | MAEMSAVPNVTVGGTSVALEHLGPIVVQLDGSLMRITDWATKTDHEKETISRVISKRNKTRLEALQASQNADLD |
| A0A2S6BXL9 | 75-171 | KPTPATDAPALDENGEPLGLPAPPSEDEATKLDLSSGADTVKLDHLGPLVVNKDGTLSRISNWEGMTEQEKKATWRILGKRNQLRTD… |
| A0A5C3LWI2 | 1-68 | None |
| A0A1J9RR18 | 147-241 | None |
| C1E5J9 | 22-124 | None |
| A0A420Y521 | 30-123 | None |
| A0A7C8L7C3 | 82-176 | None |
| A0A4Q4Y7L1 | 413-493 | None |
| A0A1C7MDG4 | 2-91 | None |
| A0A0C9Y619 | 2-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.