DPCstruct | MC25105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 90 ± 15 aa |
| Standard deviation of domain lengths | 15.46 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09809 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S7H9W9 | 135-227 | RRTPLTTKQGNKTMYKGTRSSGVGKHTRYGGYAINWDKVRTFVTPRDYNTELKPLVSHNVPELTHTFKGYSQGSLDPQLYFMKLREY… |
| A0A2T9Y0D4 | 7-78 | KGFYRGARHGVLTSKQGRNFYKGTRTGSTGHHTRHGTYVIEWDKVRTFVVPDLTNFKLKPYVSYSVPETSTP |
| B9F141 | 144-224 | None |
| A0A3Q3XH07 | 3-86 | None |
| C1EF19 | 5-79 | None |
| A0A2I0RKZ7 | 184-284 | None |
| A0A7J9EVY8 | 1-88 | None |
| A0A4P9Y344 | 2-62 | None |
| A0A2G3BJ59 | 1-74 | None |
| A0A061CZE0 | 2-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.