DPCstruct | MC25102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 211 ± 23 aa |
| Standard deviation of domain lengths | 22.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6QNN8 | 15-210 | QFWWTPDHAACAFSTQEGRYPKRQLEQPYPAPILRTNLNHDIHKKAFQVARQFPDLASGIKPVENWYHLYKYWDAVDIWTEGAGFCY… |
| A0A447BVK7 | 26-238 | AMASNGTPLPTPLMSYYFKMPRNSPCVISVNKTGKAPRFYSDPLSIPKRDIESWNQAKIEKEARTIRAQHPALADSVIRPTSWEDLY… |
| A0A446BA94 | 3-231 | None |
| A0A6V8R5K6 | 58-291 | None |
| A0A366P1T4 | 58-248 | None |
| A0A0M8N0X1 | 20-211 | None |
| A0A168FKV6 | 1-258 | None |
| A0A3N2PT89 | 1-240 | None |
| A0A1Y2UAN1 | 1-179 | None |
| A0A1Y2TI64 | 43-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.