DPCstruct | MC2510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 109 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0666 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S5FDT1 | 61-166 | MVSLTSFNYCKISNPVLKDEKGEIVFEHGAAKLRFGREEYRFNQQPFPLYPGEILSLPVTPLEIVKPNDALVLSALLDFVDSKGIKR… |
| A0A183A4I0 | 1-115 | MISIPPIHYCVVESPIVRNASGEPVYDASGQVKLRLNDTECRFQQEPFPLYPGERLKLAVKKLPVIKNNEALCLRALTDFVDDDGVR… |
| L8GWT3 | 81-201 | None |
| A0A6G3Z6Z4 | 61-182 | None |
| A0A2K5QMS6 | 50-157 | None |
| A0A818X997 | 56-162 | None |
| F4PZ19 | 140-249 | None |
| A0A654HPU6 | 5-118 | None |
| A0A267FM30 | 57-164 | None |
| A0A7J7ZXN8 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.