DPCstruct | MC251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Standard deviation of domain lengths | 11.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0141 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399WCF3 | 9-90 | MLWSIMGTIAAICTTVGFIPQIIRGIKTRELRDVSPVMLTLLLVGCSLWLVYGVHLKNPIIALANGFTLSFVMAILLLRSLF |
| M5PYD8 | 1-86 | MNSIDWVEALGLLAGAQTTIAFLPQALKVWRAKSADDISLATFLIFCSGVTCWFFYGLFIDSLSVILANAVTLVLAAAIVWLKVKY |
| K2KL14 | 5-90 | None |
| J6LJR0 | 3-83 | None |
| A0A1H4AK83 | 2-82 | None |
| A0A6C0K4E6 | 6-119 | None |
| A0A094X2I0 | 29-114 | None |
| A0A2W5EIL7 | 5-84 | None |
| A0A7W0G691 | 16-103 | None |
| A0A2N2FHP7 | 7-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.