DPCstruct | MC25096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 149 ± 19 aa |
| Standard deviation of domain lengths | 19.15 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.46 |
| Pfam Score | 92.95 |
| Assigned Pfam label(s) | CL0680- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482RYL0 | 93-232 | AAGLITCAVRRYGHIKLLQKRCREVFTRHFDKQTLNYYYYNPVYGTTSWRKPYCLRNEELFPFMSPYYAACKMQNLYHLFRAREKSR… |
| A0A418E9Q2 | 94-232 | TGKRIQRMFRCGMARRQMRGMISRVYVKIWDDTRAQFYFYNTSTKTVSWAKPKWVDEDDLMSPRTHQAFLLQEKVDAIRNGPPDAAV… |
| A0A418ATR1 | 12-148 | None |
| A0A7S2S4U7 | 3-149 | None |
| A0A7S4E5F1 | 131-285 | None |
| W4GY67 | 224-325 | None |
| A0A7S1GFH7 | 2-133 | None |
| A0A662X6H6 | 162-339 | None |
| A0A418B0T5 | 37-187 | None |
| A0A0L7L8K4 | 80-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.