DPCstruct | MC25095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 11.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.08 |
| Pfam Score | 90.11 |
| Assigned Pfam label(s) | CL0023- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WSX7 | 73-180 | AEPASSPSAHIIPQGILESSIKITNEPPTGIKANLHKALDNFSQETLELCSKEAEFKAILFSLCYFHAVVAERRKFGPQGWNKVYPF… |
| A0A482RYI0 | 10-112 | AIPLCRLWLTSEPSQYFPAYVLQNGVKMTNEPPKGMRANLLGSLSQIDDSWFETCQRKNEFKKMLFGLCFFHAAVRERRKFGPLGWN… |
| A0A5J4UTN2 | 63-173 | None |
| A0A6I9Q4J7 | 268-384 | None |
| L8Y494 | 594-712 | None |
| A0A0D2NUA9 | 390-504 | None |
| A0A5B7FKB4 | 84-168 | None |
| A0A3L8E301 | 324-430 | None |
| A0A3Q0IRD1 | 102-193 | None |
| A0A6P7DNG7 | 80-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.