DPCstruct | MC25094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 5.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 46.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482RXZ7 | 5-81 | VISSIVHVGHDYQGGQDPWPIEIEDHDGRVHSVTLEPGQMLFYESASCLHGRRQAFKGRYYASIFVHYRPLDTSVWN |
| A0A7S3H7N7 | 367-435 | HVVSAIINVDQDVDEDWPLLILDHQDNEHNIIMKPGDMVLYESAKLLHGRPEMFKGRHYDNIFIHYKPV |
| A0A7S4E2G8 | 206-274 | None |
| A0A7S4A7Z4 | 205-274 | None |
| A0A2D7I944 | 331-406 | None |
| A0A553PGD3 | 569-641 | None |
| A0A812UHA1 | 31-110 | None |
| A0A381RHN0 | 523-597 | None |
| K6YTX6 | 393-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.