DPCstruct | MC25091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 128 ± 20 aa |
| Standard deviation of domain lengths | 19.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.24 |
| Pfam Score | 93.83 |
| Assigned Pfam label(s) | CL0059- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482RPG9 | 244-384 | SAPLVSFNDAVAAAQAEWEGMLSRVHVDLPLDVPAEEAAGNLTSFYSAVYRTFLAPTQYSEADGSYMGFDGVQHTVWQGGRFLSDMS… |
| A0A5M5DX79 | 276-409 | VSTNGAKNNMAELAGLAFDELKAKGEALWEKELGKYTLTADRKTKRTFYTSAYHAALHPFIFQDVDGQFRGLDKNIEKAEGFTNYTV… |
| A0A0P0M0Y3 | 2-133 | None |
| A0A0P9CI84 | 3-127 | None |
| A0A1V3WYL2 | 49-187 | None |
| A0A1V3WPM5 | 54-193 | None |
| A0A0J8SNS9 | 76-208 | None |
| W4PKA1 | 280-392 | None |
| A0A538Q9E4 | 4-101 | None |
| A0A7Y3MLD3 | 59-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.