DPCstruct | MC25090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S6B3G2 | 1-108 | MEAKISKKRGTNTKKRNLLPLKNSREFSLQCAKKRLSGSRFRTLNERLYTSHSRDNYSYYQRNPTLFKIYHEGYREQVEKWPIDPLN… |
| A0A7J7X1Q5 | 225-307 | PPAPSQDNHEARAGALRARMAQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQ |
| A0A834AAY3 | 225-307 | None |
| A0A287U6S8 | 5-77 | None |
| A0A1E1W912 | 196-295 | None |
| A0A195CPS8 | 312-402 | None |
| I3S442 | 1-99 | None |
| Q4UCC8 | 15-90 | None |
| A0A2R2MQD2 | 1009-1088 | None |
| A0A2S2PJR5 | 92-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.