DPCstruct | MC2509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 84 ± 14 aa |
| Standard deviation of domain lengths | 13.69 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.40 |
| Pfam Score | 80.00 |
| Assigned Pfam label(s) | CL0040- CL0458 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183A3U9 | 3-84 | RIHQFLVLIGVDPTRLRFRQHLSNEMAHYACDCWDAECQTSYGWIECVGCADRSCYDLTQHARATGTRLVAEKQLSEPVNLA |
| A0A0G0XRN3 | 46-122 | FEQWLAMMKKWCAFLGLSESDLMFHEIPDNERAFYSKRTIDIEYNFPFGMKELFGLAYRTDFDLSRHQKFSGEDLSY |
| A0A6I9YKN6 | 231-309 | None |
| A0A5S9XHT9 | 80-153 | None |
| A0A7S0MC19 | 81-175 | None |
| A0A1L9UB14 | 319-415 | None |
| A0A177V6I0 | 43-125 | None |
| A0A822YG00 | 371-459 | None |
| A0A183L9Y6 | 414-494 | None |
| A0A6N6JTJ7 | 325-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.