DPCstruct | MC25089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 154 |
|---|---|
| Mean domain length (aa) | 204 ± 42 aa |
| Standard deviation of domain lengths | 41.69 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.78 |
| Pfam Score | 99.46 |
| Assigned Pfam label(s) | CL0023- CL0369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2KB05 | 355-565 | LQMQAEETKVQLEKKLKEFDFFLTESKKRVKELESFSESKYQRWKSKEGTYRSFIDHQSRALQELRGASDSLKHEILKTKRSYAEEF… |
| A0A482RKR3 | 11-198 | HTLQDFARELDALTRKLTKAINDFTDAQTVMNTLTQERDALKKRVGGMGDMEKELQDLRVIAEESKQTQKALVTANARVEELDKLYR… |
| A0A812IQ37 | 6-107 | None |
| A0A1D2NAF2 | 1-172 | None |
| A0A7S4SJZ8 | 488-700 | None |
| A0A7M3RWX4 | 93-294 | None |
| A0A7S2SUA8 | 436-692 | None |
| K3WVX7 | 1-211 | None |
| A0A146HJ27 | 117-401 | None |
| A0A0R3TIC8 | 10-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.