DPCstruct | MC25086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 4.93 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 41.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2VWI0 | 167-228 | DPVDDDIPYGCWSVQYEEIINTVVGRSLLWPGYVFYHKIQTPFYGGFYIGNGLKNVDLCFML |
| A0A482REN0 | 1-70 | MVGAGDWMDPASEDVPAGCWTLRVDEAAGKVQLRSFKWPGFFFTHEVATPRYDGVYYGSGQRNDDLSFMM |
| A0A815BJR6 | 133-193 | None |
| A0A830HZZ4 | 175-239 | None |
| A0A5A8CDT7 | 222-283 | None |
| W7KD80 | 34-108 | None |
| A0A3R6Z1E0 | 828-892 | None |
| C1MK86 | 256-315 | None |
| A0A814TAP7 | 251-325 | None |
| D8UE15 | 1159-1217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.