DPCstruct | MC25081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 48.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9RX12 | 1-76 | MAETTRQFLMSDKPLHLEASLDKEIYYHGEPINVNVHVTNNTNKTVKKVKISVRQYADICLFNTAQYKCPVAVEEA |
| A0A6J1WBW2 | 1-77 | MAENSRHFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSSKSVKKVKVAVRQYADICLFSTAQYKCPVAQIEQE |
| A0A482VZF0 | 50-128 | None |
| A0A7J8EI55 | 114-204 | None |
| A0A183WEJ3 | 1-94 | None |
| A0A2I0T3U0 | 112-203 | None |
| A0A183SU87 | 381-487 | None |
| A0A7R9AUN3 | 376-461 | None |
| A0A182TT08 | 221-309 | None |
| A0A0P7TK40 | 146-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.