DPCstruct | MC25080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 4.68 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1W9P4 | 1-90 | PGAFEQAMEDLKAYLAANKGEAAHSFWLLTEIDHWNIEKERIVVITNAALLVCKYDFIMLKCLELQRIPLSYIEKISTGPFTFPKKS… |
| C1LIK6 | 48-134 | MQQLIHYIGESVLIPEDGAFIALWILTLIDHWNNEHERLVVLTERNFYLLRYDFLQCRVRDSRRIGLGQLISVITGPLVFPAKSLMP |
| A0A6J0VTC8 | 88-177 | None |
| A0A210PUZ7 | 103-206 | None |
| A0A183RC45 | 39-123 | None |
| S9XSC8 | 182-270 | None |
| A0A3L7I0C5 | 265-351 | None |
| A0A091DRT4 | 153-242 | None |
| A0A444UHN7 | 44-133 | None |
| A0A671UR65 | 524-613 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.