DPCstruct | MC2508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 128 ± 27 aa |
| Standard deviation of domain lengths | 26.62 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05731 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183A2I8 | 3-124 | TYGSKKISLPKPMRRNMIAKFAEFDEYQLGDSHSFVNSRQTYLTMKYLIRILHIHTPTFAVMCLLRKKYPSSATEFVRLGLEGSWDP… |
| A0A6I9XG60 | 317-417 | ALEKKHREILDSVKEKAPRDLFSLKNLIHRLHISEPVQHVMSLLERRYPPDLPSFSRSRLPGPWDPTLAGTRMKLEVPQTWDRELSN… |
| A0A3P7L4B1 | 164-358 | None |
| A0A3P7Y760 | 4-121 | None |
| A0A4E0RWY5 | 213-362 | None |
| A0A5K3FK64 | 21-133 | None |
| Q54CB5 | 237-341 | None |
| A0A5C6P162 | 313-422 | None |
| A0A2G8LIZ8 | 207-319 | None |
| A0A7R9ZVV7 | 57-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.